PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 271aa    MW: 30360.1 Da    PI: 5.0763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34452.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
       KHN34452.1 14 KGPWTAEEDKKLIKFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.55.6e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
       KHN34452.1  70 LTEAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.522961IPR017930Myb domain
SuperFamilySSF466892.85E-2711108IPR009057Homeodomain-like
SMARTSM007173.8E-131363IPR001005SANT/Myb domain
PfamPF002495.5E-151461IPR001005SANT/Myb domain
CDDcd001678.80E-91661No hitNo description
PROSITE profilePS5129427.76462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2564116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1569111IPR001005SANT/Myb domain
CDDcd001673.32E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLIKFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLN KQAAASSQDS SSSPAEHLPQ PGNNLDDQVK ETNGVLLNSE ENSSSSQAEN  180
SSGDDSLLLE SICSDDSLLN SMWLDETPLV EALWDTTPNL ENTNNNMSLL PSWEENCAWL  240
LDCQDFGIHD FGFNEIEANA LQTVGMKEEG H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-29141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-29141164105C-Myb DNA-Binding Domain
1mse_C4e-29141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0988500.0BT098850.1 Soybean clone JCVI-FLGm-16B22 unknown mRNA.
GenBankKC7514530.0KC751453.1 Glycine max cultivar Jilin 32 transcription factor MYBJ1 (MYBJ1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241087.10.0protein ODORANT1-like
SwissprotQ50EX61e-105ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2RRL70.0A0A0B2RRL7_GLYSO; Protein ODORANT1
TrEMBLC6TM990.0C6TM99_SOYBN; Transcription factor MYBJ1
STRINGGLYMA05G03780.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.18e-96myb domain protein 85
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]